McDonnell Genome Institute

Washington University

Transcript

lnc-TDRD9-3:1

Chromosome

chr14

Gene Name

lnc-TDRD9-3

Start

103892245

CPC Label

noncoding

End

103894763

Cancer

OSCC

Strand

+

Peptide

SALLSRTGGSPFMPSGPGGGAR

Modified Peptide

n[145]SALLSRTGGSPFM[147]PSGPGGGAR

Peptide Length

22

ORF Length

94

Open Reading Frame (ORF)

LSAPGTPSYHPGTGQPHAPSSRYLAPCLLGRPGLGRCAGLEVTRSALLSRTGGSPFMPSGPGGGARHHSPHLPREIISPHRHTSVGAGCPPSRT

Conservation Score

0.08

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0411766

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.085

PhyloCSF Frame 3

-4.882

CNTI Score

-0.278677853