McDonnell Genome Institute

Washington University

Transcript

lnc-TDRD3-3:4

Chromosome

chr13

Gene Name

lnc-TDRD3-3

Start

63034974

CPC Label

noncoding

End

63097696

Cancer

LUAD

Strand

+

Peptide

SAGSYQK

Modified Peptide

n[230]SAGSYQK

Peptide Length

7

ORF Length

72

Open Reading Frame (ORF)

MYPSGNTYINCNTTSVGNWDTDTKRKQCHVKTEAKSGVTDVQAKNLKSAGSYQKLRVREGSSSEASPGLSTC

Conservation Score

0.135

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.204912

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9948

PhyloCSF Frame 3

0

CNTI Score

-0.410751821