McDonnell Genome Institute

Washington University

Transcript

lnc-TDRD15-8:1

Chromosome

chr2

Gene Name

lnc-TDRD15-8

Start

21171164

CPC Label

noncoding

End

21414818

Cancer

OV

Strand

+

Peptide

VTIAMLMGLGR

Modified Peptide

n[145]VTIAMLM[147]GLGR

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

LGAFENCTHQLYGDEFPRVSLRKVTIAMLMGLGRQTSHCLEL

Conservation Score

1

PhyloCSF Frame 1

-5.029

No. of Spectra

2

CPC Coding Probability

0.00651325

PhyloCSF Frame 2 

-5.085

CNTI Index

noncoding

Max Probability

0.8379

PhyloCSF Frame 3

-4.32

CNTI Score

-0.453505874