McDonnell Genome Institute

Washington University

Transcript

lnc-TDRD15-1:1

Chromosome

chr2

Gene Name

lnc-TDRD15-1

Start

21087003

CPC Label

noncoding

End

21096811

Cancer

OV

Strand

+

Peptide

DNPVQPVIVQMMK

Modified Peptide

n[145]DNPVQPVIVQM[147]MK

Peptide Length

13

ORF Length

37

Open Reading Frame (ORF)

LGRLLRDNPVQPVIVQMMKLKPAECYFFFLLNFRIEN

Conservation Score

0.034

PhyloCSF Frame 1

-5.937

No. of Spectra

7

CPC Coding Probability

0.024307

PhyloCSF Frame 2 

-6.424

CNTI Index

noncoding

Max Probability

0.7566

PhyloCSF Frame 3

-4.285

CNTI Score

-0.437193356