McDonnell Genome Institute

Washington University

Transcript

lnc-TDO2-4:1

Chromosome

chr4

Gene Name

lnc-TDO2-4

Start

156006477

CPC Label

noncoding

End

156006988

Cancer

LUAD

Strand

+

Peptide

GGQSSFK

Modified Peptide

n[230]GGQSSFK

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

LPNTFFTNLMRRGHMPRELMKLQNQRGGQSSFKISRNQTVMTGRAG

Conservation Score

1

PhyloCSF Frame 1

-5.346

No. of Spectra

3

CPC Coding Probability

0.0357848

PhyloCSF Frame 2 

-4.152

CNTI Index

noncoding

Max Probability

0.9786

PhyloCSF Frame 3

-4.805

CNTI Score

-0.371676681