McDonnell Genome Institute

Washington University

Transcript

lnc-TCP11L2-4:3

Chromosome

chr12

Gene Name

lnc-TCP11L2-4

Start

106139622

CPC Label

noncoding

End

106143621

Cancer

OV

Strand

+

Peptide

GQPPGRGGRPGTWK

Modified Peptide

n[145]GQPPGRGGRPGTWK

Peptide Length

14

ORF Length

110

Open Reading Frame (ORF)

LGQLRVQENPKSGALAPAPAPSPKKGESGTEGGREAEPRARRRTAGPPTPSGPRRGQPPGRGGRPGTWKRWGSKGAGTELAPQRRPPCQRRPPSEVGKPGTWGGPGPRAC

Conservation Score

0.999

PhyloCSF Frame 1

-2.199

No. of Spectra

1

CPC Coding Probability

0.0542318

PhyloCSF Frame 2 

-3.302

CNTI Index

noncoding

Max Probability

0.4409

PhyloCSF Frame 3

0.124

CNTI Score

-0.313471796