McDonnell Genome Institute

Washington University

Transcript

lnc-TCP11-2:4

Chromosome

chr6

Gene Name

lnc-TCP11-2

Start

35190824

CPC Label

noncoding

End

35259963

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LTTSVLVEEWAVTGAQK

Modified Peptide

n[145]LTTSVLVEEWAVTGAQK

Peptide Length

17

ORF Length

88

Open Reading Frame (ORF)

LYTNFCPHYPFFQREVFYSFLQNFHNRPPTPYPNTYTHTHTNSLSLKRLTTSVLVEEWAVTGAQKTNSPSFTICLASPASKEGPSPPP

Conservation Score

0.324

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.123665

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

0

CNTI Score

-0.253662499