McDonnell Genome Institute

Washington University

Transcript

lnc-TCP11-2:10

Chromosome

chr6

Gene Name

lnc-TCP11-2

Start

35258326

CPC Label

noncoding

End

35259419

Cancer

LUAD

Strand

-

Peptide

LRPAGEK

Modified Peptide

n[230]LRPAGEK

Peptide Length

7

ORF Length

58

Open Reading Frame (ORF)

LRPAGEKVRFGSSAGGQEAQVVRDAGPGASVSVLRAQSLQASSRPRAQHSLSYGPEAL

Conservation Score

0.856

PhyloCSF Frame 1

-0.139

No. of Spectra

11

CPC Coding Probability

0.00765915

PhyloCSF Frame 2 

-1.261

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.345683741