McDonnell Genome Institute

Washington University

Transcript

lnc-TCP10L-2:1

Chromosome

chr21

Gene Name

lnc-TCP10L-2

Start

32567845

CPC Label

noncoding

End

32569933

Cancer

OV

Strand

-

Peptide

MLNVDVEK

Modified Peptide

n[145]M[147]LNVDVEK

Peptide Length

8

ORF Length

46

Open Reading Frame (ORF)

LSSVPGSGMRPVDIFVKKMLNVDVEKMQTLRLKREEAGNSVRVTEC

Conservation Score

0.458

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.04544

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9368

PhyloCSF Frame 3

0

CNTI Score

-0.312982766