McDonnell Genome Institute

Washington University

Transcript

lnc-TCP10-3:1

Chromosome

chr6

Gene Name

lnc-TCP10-3

Start

167409666

CPC Label

noncoding

End

167426331

Cancer

OV

Strand

-

Peptide

EGSCSSELVLLGSESMVPESK

Modified Peptide

n[145]EGSCSSELVLLGSESMVPESK

Peptide Length

21

ORF Length

97

Open Reading Frame (ORF)

MRNDICVARFKTNWECREMFLEGMGLHLYLREGGLWCGWKEGSCSSELVLLGSESMVPESKGLRTATKMCPWPILELKSYLTLTTTTRRRGKGAPWD

Conservation Score

0.387

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.262619

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8713

PhyloCSF Frame 3

0

CNTI Score

-0.282546278