McDonnell Genome Institute

Washington University

Transcript

lnc-TCP1-6:1

Chromosome

chr6

Gene Name

lnc-TCP1-6

Start

159962929

CPC Label

noncoding

End

159968902

Cancer

CCRC

Strand

-

Peptide

LGAAGVPSR

Modified Peptide

n[230]LGAAGVPSR

Peptide Length

9

ORF Length

58

Open Reading Frame (ORF)

LGAAGVPSRASVSPPTAPCWIVAGASQVRATVPNLDRPVGENRELGSKCQGGKCLRTA

Conservation Score

0.071

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.107551

PhyloCSF Frame 2 

2.995

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

0

CNTI Score

-0.352297256