McDonnell Genome Institute

Washington University

Transcript

lnc-TCP1-3:1

Chromosome

chr6

Gene Name

lnc-TCP1-3

Start

159712800

CPC Label

coding

End

159713985

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LDTMTEFTGR

Modified Peptide

n[145]LDTMTEFTGR

Peptide Length

10

ORF Length

76

Open Reading Frame (ORF)

LKLDTMTEFTGRADVEFAAHEDAVAAMAKDKANMQHRYRETFLNAIGTSRGVYEHTYVELFLNLQQGQVVVLMVGK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.641263

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6682

PhyloCSF Frame 3

0

CNTI Score

-0.364302279