McDonnell Genome Institute

Washington University

Transcript

lnc-TCIRG1-1:6

Chromosome

chr11

Gene Name

lnc-TCIRG1-1

Start

68051632

CPC Label

noncoding

End

68053761

Cancer

OSCC

Strand

+

Peptide

SHMQYSETHQCHTRPAGGESSAPHAGGLGCSR

Modified Peptide

n[145]SHM[147]QYSETHQCHTRPAGGESSAPHAGGLGCSR

Peptide Length

32

ORF Length

113

Open Reading Frame (ORF)

LAPLGGEPGDREVLTLPPWPRMAVCTLHQEEGQGRSHMQYSETHQCHTRPAGGESSAPHAGGLGCSRAIRCSSFSHGTKRVKEQLLEAPGRGHLAAVTGDFAVHLCSLAVPWE

Conservation Score

0.792

PhyloCSF Frame 1

-1.731

No. of Spectra

2

CPC Coding Probability

0.208242

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8195

PhyloCSF Frame 3

0

CNTI Score

-0.292041846