McDonnell Genome Institute

Washington University

Transcript

lnc-TCF7L2-7:1

Chromosome

chr10

Gene Name

lnc-TCF7L2-7

Start

113263304

CPC Label

noncoding

End

113272065

Cancer

OV

Strand

+

Peptide

LAMTGPLPQAFHPPQLSLPCIRK

Modified Peptide

n[145]LAM[147]TGPLPQAFHPPQLSLPCIRK

Peptide Length

23

ORF Length

38

Open Reading Frame (ORF)

LAMTGPLPQAFHPPQLSLPCIRKTGVADFINGSELKLQ

Conservation Score

0.782

PhyloCSF Frame 1

-5.524

No. of Spectra

3

CPC Coding Probability

0.07868

PhyloCSF Frame 2 

-4.822

CNTI Index

noncoding

Max Probability

0.4949

PhyloCSF Frame 3

-3.744

CNTI Score

-0.362000305