McDonnell Genome Institute

Washington University

Transcript

lnc-TCF7L1-1:1

Chromosome

chr2

Gene Name

lnc-TCF7L1-1

Start

85314358

CPC Label

coding

End

85317515

Cancer

OSCC

Strand

+

Peptide

SHHTLVTRRMER

Modified Peptide

n[145]SHHTLVTRRMER

Peptide Length

12

ORF Length

91

Open Reading Frame (ORF)

LHLEVCHTKAVAQLHPCGESLGTSSPCSGSGVLRTKAWRSHHTLVTRRMERYISMPREEAAEHIPLLFFAFPSAKDPTWEDRFPRGAARPG

Conservation Score

1

PhyloCSF Frame 1

-2.509

No. of Spectra

1

CPC Coding Probability

0.533732

PhyloCSF Frame 2 

-2.703

CNTI Index

noncoding

Max Probability

0.7743

PhyloCSF Frame 3

10.7

CNTI Score

-0.284702624