McDonnell Genome Institute

Washington University

Transcript

lnc-TCEANC2-2:1

Chromosome

chr1

Gene Name

lnc-TCEANC2-2

Start

54026627

CPC Label

noncoding

End

54028499

Cancer

OV

Strand

+

Peptide

SEIYEADFNSNR

Modified Peptide

n[145]SEIYEADFNSNR

Peptide Length

12

ORF Length

52

Open Reading Frame (ORF)

LSNSVRLCLKKKKSEIYEADFNSNRFQKRSKNCAPEFNYHKELENPHYHPAS

Conservation Score

0.646

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.124313

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

0

CNTI Score

-0.391952049