McDonnell Genome Institute

Washington University

Transcript

lnc-TCAIM-2:1

Chromosome

chr3

Gene Name

lnc-TCAIM-2

Start

44440931

CPC Label

noncoding

End

44445454

Cancer

HCC

Strand

+

Peptide

GAEMGGK

Modified Peptide

n[230]GAEMGGK

Peptide Length

7

ORF Length

35

Open Reading Frame (ORF)

LSQKIKKTVKISLYWGRNFTRYPVAKGAEMGGKGC

Conservation Score

0.45

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.136394

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.309687772