McDonnell Genome Institute

Washington University

Transcript

lnc-TCAF2C-5:1

Chromosome

chr7

Gene Name

lnc-TCAF2C-5

Start

143545185

CPC Label

noncoding

End

143546735

Cancer

EOGC

Strand

-

Peptide

EIVLADVIDNDSWRLWPSVDGSQQK

Modified Peptide

n[145]EIVLADVIDNDSWRLWPSVDGSQQK

Peptide Length

25

ORF Length

117

Open Reading Frame (ORF)

LKWISCHILHRLFFEILEKSWLPQNCMLVDMKIKFGVDVTPKEIVLADVIDNDSWRLWPSVDGSQQKDKQPHQDLKEVTPEGLKMVIEKLRVGCRERRVAFEIRKSVRDGSIGRLYF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.100307

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1907

PhyloCSF Frame 3

0

CNTI Score

-0.359421759