McDonnell Genome Institute

Washington University

Transcript

lnc-TC2N-1:1

Chromosome

chr14

Gene Name

lnc-TC2N-1

Start

91756758

CPC Label

noncoding

End

91759798

Cancer

BRCA-Luminal B

Strand

-

Peptide

SSIDWIK

Modified Peptide

n[145]SSIDWIK

Peptide Length

7

ORF Length

81

Open Reading Frame (ORF)

LGSPRICNVVWQAQDPRELMVQFQSHRSLLENFLWLGEGGLFILLRSSIDWIKCTYIMEGNLLYSEDISVNVIPIQKHLPS

Conservation Score

0.138

PhyloCSF Frame 1

-2.823

No. of Spectra

45

CPC Coding Probability

0.0692669

PhyloCSF Frame 2 

-3.623

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

-5.017

CNTI Score

-0.426530341