McDonnell Genome Institute

Washington University

Transcript

lnc-TBXT-5:1

Chromosome

chr6

Gene Name

lnc-TBXT-5

Start

165797658

CPC Label

noncoding

End

165811780

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

VHLDELK

Modified Peptide

n[145]VHLDELK

Peptide Length

7

ORF Length

70

Open Reading Frame (ORF)

LELARGDGVVCTLWGSQERGQSNHPDPSARLLLEHVLIHQLSGPELGMNHRKAAVLLPLRVHLDELKTSQ

Conservation Score

0.151

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.257817

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9154

PhyloCSF Frame 3

0

CNTI Score

-0.298860226