McDonnell Genome Institute

Washington University

Transcript

lnc-TBX3-8:1

Chromosome

chr12

Gene Name

lnc-TBX3-8

Start

114894631

CPC Label

noncoding

End

114898529

Cancer

OV

Strand

-

Peptide

LLGLLPSMAADSQNKCSKGPWEK

Modified Peptide

n[145]LLGLLPSMAADSQNKCSKGPWEK

Peptide Length

23

ORF Length

81

Open Reading Frame (ORF)

LFHAVSDGIVPVRIEYSFTRRLIHMAKLSCQPGTLIPLHVDFVMRLLGLLPSMAADSQNKCSKGPWEKLKSSYDLGLKVLE

Conservation Score

0.259

PhyloCSF Frame 1

-3.904

No. of Spectra

1

CPC Coding Probability

0.0453298

PhyloCSF Frame 2 

-4.295

CNTI Index

noncoding

Max Probability

0.3883

PhyloCSF Frame 3

-3.943

CNTI Score

-0.342958617