McDonnell Genome Institute

Washington University

Transcript

lnc-TBX2-7:1

Chromosome

chr17

Gene Name

lnc-TBX2-7

Start

61069870

CPC Label

coding

End

61070341

Cancer

EOGC

Strand

+

Peptide

VNTLIWPDGEK

Modified Peptide

n[145]VNTLIWPDGEK

Peptide Length

11

ORF Length

156

Open Reading Frame (ORF)

MAPKAKKEAPAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTFRQPKTLRLWRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKTEDNNTLVFLVDVKANKHQIKQAVKKLYDIDVAKVNTLIWPDGEKKAYVRLAPGYDALDVANKIGII

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.959034

PhyloCSF Frame 2 

5.027

CNTI Index

coding

Max Probability

0.1015

PhyloCSF Frame 3

0

CNTI Score

0.742716193