McDonnell Genome Institute

Washington University

Transcript

lnc-TBX2-1:1

Chromosome

chr17

Gene Name

lnc-TBX2-1

Start

61397951

CPC Label

noncoding

End

61399459

Cancer

OV

Strand

+

Peptide

SPSWPRGSAPPGR

Modified Peptide

n[145]SPSWPRGSAPPGR

Peptide Length

13

ORF Length

88

Open Reading Frame (ORF)

LAGRREEAGISEEGDFRLRYRIGRKFVGSRVENPGSARAVPPCAQRKVRSPSWPRGSAPPGRWKAQGGARACGELQVPSESSGEGGRG

Conservation Score

1

PhyloCSF Frame 1

4.355

No. of Spectra

2

CPC Coding Probability

0.119175

PhyloCSF Frame 2 

0.138

CNTI Index

noncoding

Max Probability

0.7705

PhyloCSF Frame 3

-3.019

CNTI Score

-0.272800574