McDonnell Genome Institute

Washington University

Transcript

lnc-TBX15-6:1

Chromosome

chr1

Gene Name

lnc-TBX15-6

Start

118614332

CPC Label

noncoding

End

118615646

Cancer

BRCA-Basal-like

Strand

-

Peptide

MTLADDTTLDDLIMAK

Modified Peptide

n[145]MTLADDTTLDDLIMAK

Peptide Length

16

ORF Length

70

Open Reading Frame (ORF)

LDPALIRPGHINRNIEFPLPDEKTRKHIFQIHTSRMTLADDTTLDDLIMAKDDLSGADIKVTCREAGLWP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0363352

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2927

PhyloCSF Frame 3

0

CNTI Score

-0.346629913