McDonnell Genome Institute

Washington University

Transcript

lnc-TBX15-2:1

Chromosome

chr1

Gene Name

lnc-TBX15-2

Start

119047404

CPC Label

noncoding

End

119064785

Cancer

OV

Strand

-

Peptide

LDLEFYMGRPQNHGGR

Modified Peptide

n[145]LDLEFYMGRPQNHGGR

Peptide Length

16

ORF Length

135

Open Reading Frame (ORF)

LDLEFYMGRPQNHGGRLKALLTHQRQEKNEEEAKVETPDKPIRSGETYSLSIAWERPAPMIQLPPTGSLPQHVGILGDIIEVEIMWGHSQTISFCPWPLQISCPYISKPIMPSQQSPKVLTHFSINPKSTVQSLV

Conservation Score

0.845

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.41518

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3842

PhyloCSF Frame 3

0

CNTI Score

-0.342677821