McDonnell Genome Institute

Washington University

Transcript

lnc-TBPL1-6:1

Chromosome

chr6

Gene Name

lnc-TBPL1-6

Start

134177992

CPC Label

noncoding

End

134183848

Cancer

BRCA-Basal-like

Strand

+

Peptide

LILYSSMMSGKK

Modified Peptide

n[145]LILYSSM[147]M[147]SGKK

Peptide Length

12

ORF Length

41

Open Reading Frame (ORF)

LILYSSMMSGKKNKPRRNFWRPRTTLLAWFPIIMSHTQLIL

Conservation Score

0.243

PhyloCSF Frame 1

0

No. of Spectra

48

CPC Coding Probability

0.035982

PhyloCSF Frame 2 

-3.257

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

-3.743

CNTI Score

-0.401168631