McDonnell Genome Institute

Washington University

Transcript

lnc-TBL2-2:1

Chromosome

chr7

Gene Name

lnc-TBL2-2

Start

73609261

CPC Label

noncoding

End

73611502

Cancer

LUAD

Strand

-

Peptide

QAEAGELFEPR

Modified Peptide

n[230]QAEAGELFEPR

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

LPTWRNPVSTKNTKISGAWWRSPVIPATRQAEAGELFEPRRQRLW

Conservation Score

0.069

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0869947

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8288

PhyloCSF Frame 3

0

CNTI Score

-0.312504809