McDonnell Genome Institute

Washington University

Transcript

lnc-TBL1XR1-16:1

Chromosome

chr3

Gene Name

lnc-TBL1XR1-16

Start

175977496

CPC Label

noncoding

End

175978570

Cancer

BRCA-Luminal B

Strand

-

Peptide

KLWMTSR

Modified Peptide

n[145]KLWM[147]TSR

Peptide Length

7

ORF Length

111

Open Reading Frame (ORF)

LPSRKLWMTSRRSCARSPWTWIRRWPCLASSSFLEKSYELPYIQVITICNQLFCCPKALFQPSFLGMKSCGIHETTFNSIMKCDMDIHKDLYVNTVLSGSTTMYPSIANRM

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.357349

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6156

PhyloCSF Frame 3

0

CNTI Score

0.688789359