McDonnell Genome Institute

Washington University

Transcript

lnc-TBCK-1:1

Chromosome

chr4

Gene Name

lnc-TBCK-1

Start

106003316

CPC Label

noncoding

End

106022478

Cancer

OV

Strand

-

Peptide

YIYLTVIGGAMNIHK

Modified Peptide

n[145]YIYLTVIGGAM[147]NIHK

Peptide Length

15

ORF Length

41

Open Reading Frame (ORF)

LRVGRIRQRYTLSRVAKYIYLTVIGGAMNIHKGEAWACVED

Conservation Score

0.789

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0368217

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9737

PhyloCSF Frame 3

0

CNTI Score

-0.317732537