McDonnell Genome Institute

Washington University

Transcript

lnc-TBCD-2:3

Chromosome

chr17

Gene Name

lnc-TBCD-2

Start

82979355

CPC Label

noncoding

End

82981738

Cancer

OSCC

Strand

+

Peptide

LLESVMQR

Modified Peptide

n[145]LLESVM[147]QR

Peptide Length

8

ORF Length

41

Open Reading Frame (ORF)

MLLESVMQRTIYSQSIAYVILMNQCGNLPLLSFFQTHCNCC

Conservation Score

0.35

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0451907

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9963

PhyloCSF Frame 3

0

CNTI Score

-0.385107714