McDonnell Genome Institute

Washington University

Transcript

lnc-TBCC-1:1

Chromosome

chr6

Gene Name

lnc-TBCC-1

Start

42789259

CPC Label

noncoding

End

42791319

Cancer

OV

Strand

-

Peptide

CVPPCLAIFFVFLVEMSFAMLAR

Modified Peptide

n[145]CVPPCLAIFFVFLVEM[147]SFAM[147]LAR

Peptide Length

23

ORF Length

100

Open Reading Frame (ORF)

LPQIFKCSFFFFFFLRQSSYVTQAGVQWEDLSSLQCLPSRFKQFSCLSLLSSWDYRCVPPCLAIFFVFLVEMSFAMLARLVLNSWPQTICLPQPPKVLGL

Conservation Score

0.033

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0970418

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7193

PhyloCSF Frame 3

0

CNTI Score

-0.386285151