McDonnell Genome Institute

Washington University

Transcript

lnc-TBCA-7:1

Chromosome

chr5

Gene Name

lnc-TBCA-7

Start

78041878

CPC Label

noncoding

End

78044138

Cancer

BRCA-Luminal A

Strand

-

Peptide

EDQTEYLEERK

Modified Peptide

n[145]EDQTEYLEERK

Peptide Length

11

ORF Length

52

Open Reading Frame (ORF)

LGVSAGGSFTVCADHGEPIGRGTKVTLHLKEDQTEYLEERKVKEVVKSTYSS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.215799

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

0.684868795