McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D8-7:1

Chromosome

chr2

Gene Name

lnc-TBC1D8-7

Start

100993675

CPC Label

noncoding

End

101002244

Cancer

BRCA-Luminal A

Strand

-

Peptide

GWCLYLEK

Modified Peptide

n[145]GWCLYLEK

Peptide Length

8

ORF Length

75

Open Reading Frame (ORF)

LLLTVQRGWCLYLEKKEQRASEVVLMSAPQLSYKAVRGMLQVELDYRAVFLGGSCGERWLWQDLGVWWGWGLREP

Conservation Score

1

PhyloCSF Frame 1

9.791

No. of Spectra

1

CPC Coding Probability

0.396096

PhyloCSF Frame 2 

-3.995

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-2.961

CNTI Score

-0.321390423