McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D7-1:6

Chromosome

chr6

Gene Name

lnc-TBC1D7-1

Start

13273390

CPC Label

noncoding

End

13283441

Cancer

PRAD

Strand

-

Peptide

VAGITAMVK

Modified Peptide

Peptide Length

9

ORF Length

61

Open Reading Frame (ORF)

LLPRLEFNGAMISAHCNLRLLGASNSPASASRVAGITAMVKGSFPRMRASDRHARDQLWES

Conservation Score

0.366

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0351741

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5266

PhyloCSF Frame 3

0

CNTI Score

-0.350365162