McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D4-2:8

Chromosome

chr13

Gene Name

lnc-TBC1D4-2

Start

74649344

CPC Label

noncoding

End

74732864

Cancer

OV

Strand

-

Peptide

IFVDSSSFDQQK

Modified Peptide

n[145]IFVDSSSFDQQK

Peptide Length

12

ORF Length

47

Open Reading Frame (ORF)

LFNQDHPQEPKGVSQGEVMEVCRGKALRRRERIFVDSSSFDQQKLPV

Conservation Score

0.037

PhyloCSF Frame 1

-4.021

No. of Spectra

5

CPC Coding Probability

0.0127651

PhyloCSF Frame 2 

-5.147

CNTI Index

noncoding

Max Probability

0.8699

PhyloCSF Frame 3

-4.873

CNTI Score

-0.379977807