McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D32-3:1

Chromosome

chr6

Gene Name

lnc-TBC1D32-3

Start

121679971

CPC Label

noncoding

End

121680459

Cancer

BRCA-Luminal B

Strand

-

Peptide

LLTAESAMK

Modified Peptide

n[145]LLTAESAMK

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

LLTAESAMKKTEDNNTLVFIVDVKANKHRIKQAMKKLYDIDVAKVNTLI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.158456

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8298

PhyloCSF Frame 3

0

CNTI Score

0.676929282