McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D2B-3:2

Chromosome

chr15

Gene Name

lnc-TBC1D2B-3

Start

77939258

CPC Label

noncoding

End

77942690

Cancer

CCRC

Strand

-

Peptide

LSFMLSGTAK

Modified Peptide

n[230]LSFMLSGTAK

Peptide Length

10

ORF Length

68

Open Reading Frame (ORF)

LSFMLSGTAKHSVDGESLASELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRSKYEASQGPGSS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.346185

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6061

PhyloCSF Frame 3

0

CNTI Score

-0.284194843