McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D2B-1:1

Chromosome

chr15

Gene Name

lnc-TBC1D2B-1

Start

77954074

CPC Label

noncoding

End

77963654

Cancer

OV

Strand

-

Peptide

SEAGGLLEPGRSR

Modified Peptide

n[145]SEAGGLLEPGRSR

Peptide Length

13

ORF Length

44

Open Reading Frame (ORF)

LSNMVKLRLYKKQKKSSVEACTCGFSYSRSEAGGLLEPGRSRLQ

Conservation Score

0.085

PhyloCSF Frame 1

0

No. of Spectra

36

CPC Coding Probability

0.067067

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6884

PhyloCSF Frame 3

0

CNTI Score

-0.373182004