McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D29-5:1

Chromosome

chr17

Gene Name

lnc-TBC1D29-5

Start

30624264

CPC Label

noncoding

End

30624775

Cancer

EOGC

Strand

+

Peptide

VGGSEGTK

Modified Peptide

n[145]VGGSEGTK

Peptide Length

8

ORF Length

43

Open Reading Frame (ORF)

LLVAGLKKQFYKASQLVSEKVGGSEGTKLDNDFKEMEMSSARR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.037863

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6107

PhyloCSF Frame 3

0

CNTI Score

-0.278231911