McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D28-7:11

Chromosome

chr17

Gene Name

lnc-TBC1D28-7

Start

18523805

CPC Label

noncoding

End

18533034

Cancer

GBM

Strand

-

Peptide

LVLLDPVLK

Modified Peptide

n[230]LVLLDPVLK

Peptide Length

9

ORF Length

39

Open Reading Frame (ORF)

LACLARTNLGKLVLLDPVLKYVFQLGSILLVFFRYPNPS

Conservation Score

0.207

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.019597

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9616

PhyloCSF Frame 3

0

CNTI Score

-0.401606136