McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D28-2:2

Chromosome

chr17

Gene Name

lnc-TBC1D28-2

Start

18620085

CPC Label

coding

End

18625541

Cancer

EOGC

Strand

-

Peptide

GSSSLLMASWGGEKR

Modified Peptide

n[145]GSSSLLM[147]ASWGGEKR

Peptide Length

15

ORF Length

193

Open Reading Frame (ORF)

LLGGCGRGSSSLLMASWGGEKRGGAEGSPKLAVYATRKTRSVRSQEDQWYLGYPGDQWSSGFSYSWWKNSVGSESKHGEGALDQPQHDVRLEDLGELHRAARSGDVPGVEHVLAPGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPEYRHLKILLGPAQWCMPVISSLWEAEMGGSLEPRSSRPAQAT

Conservation Score

0.431

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.944422

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8277

PhyloCSF Frame 3

0

CNTI Score

0.719640914