McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D22A-6:1

Chromosome

chr22

Gene Name

lnc-TBC1D22A-6

Start

47278731

CPC Label

coding

End

47284450

Cancer

OSCC

Strand

+

Peptide

GGPWAGAGSLEK

Modified Peptide

n[145]GGPWAGAGSLEK

Peptide Length

12

ORF Length

214

Open Reading Frame (ORF)

LTHPGSGGRLWPVPSPSCCCNKEAEMNTKTKAAPAPWAQWTRGKDPLFPSLSEAQERAALSVSRTDCSECSKGCLFLKRNSPPENYPSQYFAVFSHFSSQTLNSLASAKGLRVTVSGYYPCHLERCRSPALQRPSKALAPVSSPLQMLLSSGIEDLISASDAWPVRGGPWAGAGSLEKGDVTQVPQPGLERENLSPKEVSPLSPAASWGGSVCL

Conservation Score

0.372

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.568428

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7921

PhyloCSF Frame 3

0

CNTI Score

-0.335803417