McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D22A-5:1

Chromosome

chr22

Gene Name

lnc-TBC1D22A-5

Start

47259365

CPC Label

noncoding

End

47261007

Cancer

OV

Strand

+

Peptide

LDNSQVFPCGNHLQVANGFWVMK

Modified Peptide

n[145]LDNSQVFPCGNHLQVANGFWVMK

Peptide Length

23

ORF Length

162

Open Reading Frame (ORF)

LEVSQSDHTLNQEVRLKPAVFFNQEVRLWPGVSFNQEVRLWPGVSSTERLNHGQLFHSTQRLDCSQVSPSTKRLDRGEVSPSAERPQPVPPSTNRLDHGQVPPSTERLDCSQVFHSTKRLDHGQVSPSIKRLDNSQVFPCGNHLQVANGFWVMKSAQCVTAR

Conservation Score

0.981

PhyloCSF Frame 1

0

No. of Spectra

32

CPC Coding Probability

0.0159801

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.314584904