McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D22A-4:4

Chromosome

chr22

Gene Name

lnc-TBC1D22A-4

Start

47631596

CPC Label

noncoding

End

47642864

Cancer

EOGC

Strand

+

Peptide

LTISYATK

Modified Peptide

n[145]LTISYATK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LTISYATKRISLNPKHRNNTISLLLPQAIELEANCSINKTKRFAH

Conservation Score

0.982

PhyloCSF Frame 1

-5.01

No. of Spectra

35

CPC Coding Probability

0.316722

PhyloCSF Frame 2 

-4.293

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-5.49

CNTI Score

-0.327707541