McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D19-8:1

Chromosome

chr4

Gene Name

lnc-TBC1D19-8

Start

26432992

CPC Label

noncoding

End

26434919

Cancer

OV

Strand

+

Peptide

SAPITHFSLIS

Modified Peptide

n[145]SAPITHFSLIS

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

LRFSLTASLFNHPQAAFYSISPFFFKSAPITHFSLIS

Conservation Score

1

PhyloCSF Frame 1

-3.488

No. of Spectra

7

CPC Coding Probability

0.0443542

PhyloCSF Frame 2 

-5.596

CNTI Index

noncoding

Max Probability

0.5957

PhyloCSF Frame 3

-3.294

CNTI Score

-0.470360363