McDonnell Genome Institute

Washington University

Transcript

lnc-TBC1D17-1:1

Chromosome

chr19

Gene Name

lnc-TBC1D17-1

Start

49870721

CPC Label

noncoding

End

49871107

Cancer

OV

Strand

+

Peptide

LEGGTVGTQASSLK

Modified Peptide

n[145]LEGGTVGTQASSLK

Peptide Length

14

ORF Length

111

Open Reading Frame (ORF)

LCCHESQAQRAAAGGPRPHQALFLVFSAHCFIEGGCTEKVTTVTAGLHIRTLRLEGGTVGTQASSLKAHSSFLKHTWVPVPALPLREVTCPLSASVSPLLQGGSVKGEEDP

Conservation Score

0.105

PhyloCSF Frame 1

0.151

No. of Spectra

1

CPC Coding Probability

0.0397409

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9872

PhyloCSF Frame 3

-2.386

CNTI Score

-0.336299695