McDonnell Genome Institute

Washington University

Transcript

lnc-TAX1BP1-4:2

Chromosome

chr7

Gene Name

lnc-TAX1BP1-4

Start

28409375

CPC Label

coding

End

28410753

Cancer

OV

Strand

+

Peptide

FLEGQDAK

Modified Peptide

n[145]FLEGQDAK

Peptide Length

8

ORF Length

278

Open Reading Frame (ORF)

MLTWSRRRVRPACVRVWERASPLTRGPVMNRGCVFASRDLARCGALQKCGQAAAETASQEPPPASPASQRGGGTPGESLQTSSGRGEDAGSPRGRVGARAGGSLSPVRSCSCHLSRRAAGCSGWARARGGEVALGGRLAFAPGAPGWRAARLRPLQSTPPAASCLRCFLAGIVTSSRPLPQMTAPARALAAPRQFPRPGGGVSPCGRFSAESLELFTKFLEGQDAKEGTKEMFSLSSCIPLLLCHRFIFKGRLVDKALDLVHTLTPIPNFPWTGAAPT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.895902

PhyloCSF Frame 2 

3.999

CNTI Index

noncoding

Max Probability

0.926

PhyloCSF Frame 3

0.339

CNTI Score

-0.27175738