McDonnell Genome Institute

Washington University

Transcript

lnc-TASP1-14:1

Chromosome

chr20

Gene Name

lnc-TASP1-14

Start

12595879

CPC Label

noncoding

End

12597718

Cancer

PRAD

Strand

-

Peptide

IPRVTLK

Modified Peptide

‚Äč

Peptide Length

7

ORF Length

62

Open Reading Frame (ORF)

LVGYRIPRVTLKTGTGSRQMCDSFITNNRNNFHRLMGEKSVLSVGLGNMERKVWSIRIHLWP

Conservation Score

0.678

PhyloCSF Frame 1

-2.951

No. of Spectra

16

CPC Coding Probability

0.022342

PhyloCSF Frame 2 

-5.193

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-4.435

CNTI Score

-0.373926386