McDonnell Genome Institute

Washington University

Transcript

lnc-TAS2R1-9:2

Chromosome

chr5

Gene Name

lnc-TAS2R1-9

Start

9361752

CPC Label

noncoding

End

9361986

Cancer

CCRC

Strand

-

Peptide

VPTNETMNGTK

Modified Peptide

n[230]VPTNETMNGTK

Peptide Length

11

ORF Length

40

Open Reading Frame (ORF)

LVMVNSSQRVPTNETMNGTKRISRTISDRIWTLDPQNRPT

Conservation Score

0.028

PhyloCSF Frame 1

-5.426

No. of Spectra

16

CPC Coding Probability

0.145431

PhyloCSF Frame 2 

-1.959

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-4.695

CNTI Score

-0.48440062