McDonnell Genome Institute

Washington University

Transcript

lnc-TAS1R3-4:1

Chromosome

chr1

Gene Name

lnc-TAS1R3-4

Start

1375595

CPC Label

noncoding

End

1376861

Cancer

EOGC

Strand

+

Peptide

GVEQSLLGLLGDLPCRR

Modified Peptide

n[145]GVEQSLLGLLGDLPCRR

Peptide Length

17

ORF Length

63

Open Reading Frame (ORF)

LTSVRLANIETPAWTCRGAWWERGVEQSLLGLLGDLPCRRVFQGRLAGSGKARSSAGPSLAKQ

Conservation Score

0.211

PhyloCSF Frame 1

-4.701

No. of Spectra

3

CPC Coding Probability

0.0198727

PhyloCSF Frame 2 

-3.872

CNTI Index

noncoding

Max Probability

0.7855

PhyloCSF Frame 3

-3.354

CNTI Score

-0.314773132